PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_7755.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NF-YB
Protein Properties Length: 183aa    MW: 19285.4 Da    PI: 6.5104
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_7755.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB1711.4e-5340135297
        NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                  +eqdr+lPianv+rimk+vlP nak+sk+aket+qecvsefisfvt+easdkc++ekrkt+ngdd++wa++ lGf+dyv+p++ yl k+releg++
  MLOC_7755.1  40 KEQDRLLPIANVGRIMKQVLPPNAKVSKEAKETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDVCWAFSALGFDDYVDPMRRYLLKFRELEGDR 135
                  89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-4936140IPR009072Histone-fold
SuperFamilySSF471131.26E-3742139IPR009072Histone-fold
PfamPF008081.2E-2645108IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.5E-177391No hitNo description
PROSITE patternPS0068507692IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.5E-1792110No hitNo description
PRINTSPR006154.5E-17111129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MADHHHHYTQ LGGGSGSGGG GGSPPELLHG GGGSGDQGIK EQDRLLPIAN VGRIMKQVLP  60
PNAKVSKEAK ETMQECVSEF ISFVTGEASD KCHKEKRKTV NGDDVCWAFS ALGFDDYVDP  120
MRRYLLKFRE LEGDRAAAAA SSRGGLPVPD ASTSGAGASG SGNFMFEAMD RRDNTGPGAG  180
RQF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g92_B3e-4339130192Transcription factor HapC (Eurofung)
4g91_B3e-4339130192Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003567445.12e-77PREDICTED: nuclear transcription factor Y subunit B-1-like
SwissprotO822484e-56NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLM0Z5S01e-133M0Z5S0_HORVD; Uncharacterized protein
STRINGMLOC_7755.11e-133(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29173887
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.16e-56nuclear factor Y, subunit B5